Lineage for d4ko8a1 (4ko8 A:14-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412093Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2412166Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2412374Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 2412375Protein automated matches [191195] (10 species)
    not a true protein
  7. 2412404Species Human (Homo sapiens) [TaxId:9606] [255865] (6 PDB entries)
  8. 2412407Domain d4ko8a1: 4ko8 A:14-106 [253360]
    Other proteins in same PDB: d4ko8a2, d4ko8a3, d4ko8b2, d4ko8b3
    automated match to d1e32a1
    complexed with ags, mg; mutant

Details for d4ko8a1

PDB Entry: 4ko8 (more details), 1.98 Å

PDB Description: Structure of p97 N-D1 R155H mutant in complex with ATPgS
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d4ko8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ko8a1 b.52.2.0 (A:14-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivls
ddtcsdekirmnrvvrnnlrvrlgdvisiqpcp

SCOPe Domain Coordinates for d4ko8a1:

Click to download the PDB-style file with coordinates for d4ko8a1.
(The format of our PDB-style files is described here.)

Timeline for d4ko8a1: