| Class b: All beta proteins [48724] (178 folds) |
| Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) ![]() |
| Family b.52.2.0: automated matches [191648] (1 protein) not a true family |
| Protein automated matches [191195] (10 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255865] (6 PDB entries) |
| Domain d4ko8b1: 4ko8 B:17-106 [253363] Other proteins in same PDB: d4ko8a2, d4ko8a3, d4ko8b2, d4ko8b3 automated match to d1e32a1 complexed with ags, mg; mutant |
PDB Entry: 4ko8 (more details), 1.98 Å
SCOPe Domain Sequences for d4ko8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ko8b1 b.52.2.0 (B:17-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddt
csdekirmnrvvrnnlrvrlgdvisiqpcp
Timeline for d4ko8b1: