SCOPe 2.04: Domain d4ko8a1: 4ko8 A:14-106

Lineage for d4ko8a1 (4ko8 A:14-106)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.0: automated matches [191648] (1 protein)
   not a true family

6. Protein automated matches [191195] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255865] (6 PDB entries)

8. Domain d4ko8a1: 4ko8 A:14-106 [253360]
   Other proteins in same PDB: d4ko8a2, d4ko8a3, d4ko8b2, d4ko8b3
   automated match to d1e32a1
   complexed with ags, mg; mutant

Details for d4ko8a1

PDB Entry: 4ko8, 1.98 Å

PDB Description: Structure of p97 N-D1 R155H mutant in complex with ATPgS

PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d4ko8a1:

Sequence; same for both SEQRES and ATOM records:

>d4ko8a1 b.52.2.0 (A:14-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivls
ddtcsdekirmnrvvrnnlrvrlgdvisiqpcp

Timeline for d4ko8a1:

• d4ko8a1 is new in SCOPe 2.04-stable
  
• d4ko8a1 appears in SCOPe 2.05
  
• d4ko8a1 appears in the current release, SCOPe 2.08