Lineage for d4klne1 (4kln E:12-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412093Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2412166Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2412374Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 2412375Protein automated matches [191195] (10 species)
    not a true protein
  7. 2412404Species Human (Homo sapiens) [TaxId:9606] [255865] (6 PDB entries)
  8. 2412425Domain d4klne1: 4kln E:12-106 [253330]
    Other proteins in same PDB: d4klna2, d4klna3, d4klnb2, d4klnb3, d4klnc2, d4klnc3, d4klnd2, d4klnd3, d4klne2, d4klne3, d4klnf2, d4klnf3
    automated match to d1e32a1
    complexed with ags, mg; mutant

Details for d4klne1

PDB Entry: 4kln (more details), 2.62 Å

PDB Description: Structure of p97 N-D1 A232E mutant in complex with ATPgS
PDB Compounds: (E:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d4klne1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4klne1 b.52.2.0 (E:12-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavciv
lsddtcsdekirmnrvvrnnlrvrlgdvisiqpcp

SCOPe Domain Coordinates for d4klne1:

Click to download the PDB-style file with coordinates for d4klne1.
(The format of our PDB-style files is described here.)

Timeline for d4klne1: