| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) ![]() |
| Family d.31.1.0: automated matches [254296] (1 protein) not a true family |
| Protein automated matches [254681] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255866] (6 PDB entries) |
| Domain d4klne2: 4kln E:107-200 [253331] Other proteins in same PDB: d4klna1, d4klna3, d4klnb1, d4klnb3, d4klnc1, d4klnc3, d4klnd1, d4klnd3, d4klne1, d4klne3, d4klnf1, d4klnf3 automated match to d1e32a3 complexed with ags, mg; mutant |
PDB Entry: 4kln (more details), 2.62 Å
SCOPe Domain Sequences for d4klne2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4klne2 d.31.1.0 (E:107-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikredeeeslne
Timeline for d4klne2: