Lineage for d1nmf__ (1nmf -)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 229103Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 229270Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins)
    barrel, closed; n=5, S=8
  6. 229290Protein Major cold shock protein [50283] (4 species)
  7. 229304Species Bacillus subtilis [TaxId:1423] [50285] (4 PDB entries)
  8. 229307Domain d1nmf__: 1nmf - [25323]

Details for d1nmf__

PDB Entry: 1nmf (more details)

PDB Description: major cold-shock protein, nmr, 20 structures

SCOP Domain Sequences for d1nmf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmf__ b.40.4.5 (-) Major cold shock protein {Bacillus subtilis}
mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
anvtkea

SCOP Domain Coordinates for d1nmf__:

Click to download the PDB-style file with coordinates for d1nmf__.
(The format of our PDB-style files is described here.)

Timeline for d1nmf__: