SCOPe 2.04: Domain d4k29c_: 4k29 C:

Lineage for d4k29c_ (4k29 C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (46 species)
   not a true protein

7. Species Xanthobacter autotrophicus [TaxId:78245] [256339] (1 PDB entry)

8. Domain d4k29c_: 4k29 C: [253143]
   automated match to d4olqe_
   complexed with gol, tla

Details for d4k29c_

PDB Entry: 4k29, 1.66 Å

PDB Description: Crystal structure of an enoyl-CoA hydratase/isomerase from Xanthobacter autotrophicus Py2

PDB Compounds: (C:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d4k29c_:

Sequence; same for both SEQRES and ATOM records:

>d4k29c_ c.14.1.0 (C:) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}
yskilyetlhgvaritlnrpertnaldqemlgeinaamdaaeadagvkavivrgagnafs
sgfdlkaqmearpagvdawrpllrkdfdtvmrfwhcpkptiaavrgpclagacelalacd
mtiatedaffgepelkfgagivvmllpwivgpkiakeiillgedrvparraaeigmvnrv
vdgdgldaealriarhigaidpglvketkralnraletqgmlqalesaleidlaiegags
pdkiaffevarrdglraaiawrdarfpa

Timeline for d4k29c_:

• d4k29c_ is new in SCOPe 2.04-stable
  
• d4k29c_ appears in SCOPe 2.05
  
• d4k29c_ appears in the current release, SCOPe 2.08