Lineage for d4olqe_ (4olq E:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1584360Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1584361Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1585212Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1585213Protein automated matches [190246] (46 species)
    not a true protein
  7. 1585362Species Hyphomonas neptunium [TaxId:228405] [237710] (1 PDB entry)
  8. 1585367Domain d4olqe_: 4olq E: [237712]
    automated match to d4k2na_
    complexed with mlt, p6g, peg, pg4, unl

Details for d4olqe_

PDB Entry: 4olq (more details), 2.7 Å

PDB Description: crystal structure of a putative enoyl-coa hydratase/isomerase family protein from hyphomonas neptunium
PDB Compounds: (E:) Enoyl-CoA hydratase/isomerase family protein

SCOPe Domain Sequences for d4olqe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4olqe_ c.14.1.0 (E:) automated matches {Hyphomonas neptunium [TaxId: 228405]}
vdlgtenlyfqsmtlpirldiaaplaeivlnkperrnalsvdmwaaipglvaeananpdv
klilihggdagafaagadisefetiyatedaakasgqriaqaldaiensekpviaaiega
cvgggvslamaadlrvagegakfgvtpgklglvypagdtrrllaavgpgatkdilftgri
ftageakslglidrlvekgtaleaarvwageiaaisqwsvratkrmirglqtgwtdetpe
aqslflngfanedfkegyrafldkrpakftyr

SCOPe Domain Coordinates for d4olqe_:

Click to download the PDB-style file with coordinates for d4olqe_.
(The format of our PDB-style files is described here.)

Timeline for d4olqe_: