Lineage for d4k29c_ (4k29 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854431Species Xanthobacter autotrophicus [TaxId:78245] [256339] (1 PDB entry)
  8. 2854434Domain d4k29c_: 4k29 C: [253143]
    automated match to d4olqe_
    complexed with gol, tla

Details for d4k29c_

PDB Entry: 4k29 (more details), 1.66 Å

PDB Description: Crystal structure of an enoyl-CoA hydratase/isomerase from Xanthobacter autotrophicus Py2
PDB Compounds: (C:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d4k29c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k29c_ c.14.1.0 (C:) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}
yskilyetlhgvaritlnrpertnaldqemlgeinaamdaaeadagvkavivrgagnafs
sgfdlkaqmearpagvdawrpllrkdfdtvmrfwhcpkptiaavrgpclagacelalacd
mtiatedaffgepelkfgagivvmllpwivgpkiakeiillgedrvparraaeigmvnrv
vdgdgldaealriarhigaidpglvketkralnraletqgmlqalesaleidlaiegags
pdkiaffevarrdglraaiawrdarfpa

SCOPe Domain Coordinates for d4k29c_:

Click to download the PDB-style file with coordinates for d4k29c_.
(The format of our PDB-style files is described here.)

Timeline for d4k29c_: