Lineage for d1quqd_ (1quq D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2398969Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. Protein Replication protein A 14 KDa (RPA14) subunit [50271] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [50272] (2 PDB entries)
  8. 2399036Domain d1quqd_: 1quq D: [25306]
    Other proteins in same PDB: d1quqa_, d1quqc_
    protein/DNA complex

Details for d1quqd_

PDB Entry: 1quq (more details), 2.5 Å

PDB Description: complex of replication protein a subunits rpa14 and rpa32
PDB Compounds: (D:) protein (replication protein a 14 kd subunit)

SCOPe Domain Sequences for d1quqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1quqd_ b.40.4.3 (D:) Replication protein A 14 KDa (RPA14) subunit {Human (Homo sapiens) [TaxId: 9606]}
dmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmepldee
isgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplgi

SCOPe Domain Coordinates for d1quqd_:

Click to download the PDB-style file with coordinates for d1quqd_.
(The format of our PDB-style files is described here.)

Timeline for d1quqd_: