Lineage for d1quqd_ (1quq D:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14109Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (6 proteins)
  6. 14113Protein Replication protein A 14 KDa (RPA14) subunit [50271] (1 species)
  7. 14114Species Human (Homo sapiens) [TaxId:9606] [50272] (1 PDB entry)
  8. 14116Domain d1quqd_: 1quq D: [25306]
    Other proteins in same PDB: d1quqa_, d1quqc_

Details for d1quqd_

PDB Entry: 1quq (more details), 2.5 Å

PDB Description: complex of replication protein a subunits rpa14 and rpa32

SCOP Domain Sequences for d1quqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1quqd_ b.40.4.3 (D:) Replication protein A 14 KDa (RPA14) subunit {Human (Homo sapiens)}
dmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmepldee
isgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplgi

SCOP Domain Coordinates for d1quqd_:

Click to download the PDB-style file with coordinates for d1quqd_.
(The format of our PDB-style files is described here.)

Timeline for d1quqd_: