Lineage for d1quqa_ (1quq A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 229103Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 229167Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (8 proteins)
    barrel, closed; n=5, S=10
  6. 229196Protein Replication protein A 32 KDa subunit (RPA32) fragment [50269] (1 species)
  7. 229197Species Human (Homo sapiens) [TaxId:9606] [50270] (2 PDB entries)
  8. 229198Domain d1quqa_: 1quq A: [25303]
    Other proteins in same PDB: d1quqb_, d1quqd_

Details for d1quqa_

PDB Entry: 1quq (more details), 2.5 Å

PDB Description: complex of replication protein a subunits rpa14 and rpa32

SCOP Domain Sequences for d1quqa_:

Sequence, based on SEQRES records: (download)

>d1quqa_ b.40.4.3 (A:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens)}
hivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmdv
rqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevin
ahmvlsk

Sequence, based on observed residues (ATOM records): (download)

>d1quqa_ b.40.4.3 (A:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens)}
hivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmdv
rqwvdtntvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevinahmvls
k

SCOP Domain Coordinates for d1quqa_:

Click to download the PDB-style file with coordinates for d1quqa_.
(The format of our PDB-style files is described here.)

Timeline for d1quqa_: