Lineage for d1quqa_ (1quq A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14109Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (6 proteins)
  6. 14117Protein Replication protein A 32 KDa subunit (RPA32) fragment [50269] (1 species)
  7. 14118Species Human (Homo sapiens) [TaxId:9606] [50270] (1 PDB entry)
  8. 14119Domain d1quqa_: 1quq A: [25303]
    Other proteins in same PDB: d1quqb_, d1quqd_

Details for d1quqa_

PDB Entry: 1quq (more details), 2.5 Å

PDB Description: complex of replication protein a subunits rpa14 and rpa32

SCOP Domain Sequences for d1quqa_:

Sequence, based on SEQRES records: (download)

>d1quqa_ b.40.4.3 (A:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens)}
hivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmdv
rqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevin
ahmvlsk

Sequence, based on observed residues (ATOM records): (download)

>d1quqa_ b.40.4.3 (A:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens)}
hivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmdv
rqwvdtntvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevinahmvls
k

SCOP Domain Coordinates for d1quqa_:

Click to download the PDB-style file with coordinates for d1quqa_.
(The format of our PDB-style files is described here.)

Timeline for d1quqa_: