Lineage for d4jm2f1 (4jm2 F:1-97)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510334Protein CD4 V-set domains [48737] (2 species)
  7. 1510335Species Human (Homo sapiens) [TaxId:9606] [48738] (31 PDB entries)
  8. 1510359Domain d4jm2f1: 4jm2 F:1-97 [252985]
    Other proteins in same PDB: d4jm2b1, d4jm2b2, d4jm2c1, d4jm2c2, d4jm2e_, d4jm2f2
    automated match to d2nxyb1
    complexed with nag, pg4

Details for d4jm2f1

PDB Entry: 4jm2 (more details), 3.1 Å

PDB Description: crystal structure of pgt 135 fab in complex with gp120 core protein from hiv-1 strain jr-fl bound to cd4 and 17b fab
PDB Compounds: (F:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d4jm2f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jm2f1 b.1.1.1 (F:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOPe Domain Coordinates for d4jm2f1:

Click to download the PDB-style file with coordinates for d4jm2f1.
(The format of our PDB-style files is described here.)

Timeline for d4jm2f1: