| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein CD4 V-set domains [48737] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48738] (33 PDB entries) |
| Domain d4jm2f1: 4jm2 F:1-97 [252985] Other proteins in same PDB: d4jm2a_, d4jm2b1, d4jm2b2, d4jm2c1, d4jm2c2, d4jm2e_, d4jm2f2 automated match to d2nxyb1 complexed with nag, pg4 |
PDB Entry: 4jm2 (more details), 3.1 Å
SCOPe Domain Sequences for d4jm2f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jm2f1 b.1.1.1 (F:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d4jm2f1: