SCOPe 2.04: Domain d4jm2c1: 4jm2 C:1-109

Lineage for d4jm2c1 (4jm2 C:1-109)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)

8. Domain d4jm2c1: 4jm2 C:1-109 [252982]
   Other proteins in same PDB: d4jm2b1, d4jm2b2, d4jm2c2, d4jm2e_, d4jm2f1, d4jm2f2
   automated match to d2nxyc1
   complexed with nag, pg4

Details for d4jm2c1

PDB Entry: 4jm2, 3.1 Å

PDB Description: crystal structure of pgt 135 fab in complex with gp120 core protein from hiv-1 strain jr-fl bound to cd4 and 17b fab

PDB Compounds: (C:) 17b Light chain

SCOPe Domain Sequences for d4jm2c1:

Sequence; same for both SEQRES and ATOM records:

>d4jm2c1 b.1.1.1 (C:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa
rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleikrt

Timeline for d4jm2c1:

• d4jm2c1 is new in SCOPe 2.04-stable
  
• d4jm2c1 appears in SCOPe 2.05
  
• d4jm2c1 appears in the current release, SCOPe 2.08