Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
Domain d4jm2b1: 4jm2 B:1-106 [252980] Other proteins in same PDB: d4jm2b2, d4jm2c1, d4jm2c2, d4jm2e_, d4jm2f1, d4jm2f2 automated match to d1dn0a1 complexed with nag, pg4 |
PDB Entry: 4jm2 (more details), 3.1 Å
SCOPe Domain Sequences for d4jm2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jm2b1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivmtqspdtlsvspgetvtlscrasqninknlawyqykpgqsprlvifetyskiaafpa rfvasgsgteftltinnmqsedvavyycqqyeewprtfgqgtkvdi
Timeline for d4jm2b1: