SCOPe 2.07: Domain d4ic5c_: 4ic5 C:

Lineage for d4ic5c_ (4ic5 C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (33 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256299] (1 PDB entry)

8. Domain d4ic5c_: 4ic5 C: [252608]
   automated match to d3stia_
   complexed with ca

Details for d4ic5c_

PDB Entry: 4ic5, 2.61 Å

PDB Description: Crystal structure of Deg5

PDB Compounds: (C:) Protease Do-like 5, chloroplastic

SCOPe Domain Sequences for d4ic5c_:

Sequence, based on SEQRES records:

>d4ic5c_ b.47.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eeleeeeernvnlfqktspsvvyieaielpktssgdiltdeengkiegtgsgfvwdklgh
ivtnyhviaklatdqfglqrckvslvdakgtrfskegkivgldpdndlavlkietegrel
npvvlgtsndlrvgqscfaignpygyentltigvvsglgreipspngksiseaiqtdadi
nsgnaggplldsyghtigvntatftrkgsgmssgvnfaipidtvvrtvpylivygta

Sequence, based on observed residues (ATOM records):

>d4ic5c_ b.47.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eeleeeeernvnlfqktspsvvyieaielgtgsgfvwdklghivtnyhviaklatdqfgl
qrckvslvdakgtrfskegkivgldpdndlavlkietegrelnpvvlgtsndlrvgqscf
aignpygyentltigvvsglgreipspngksiseaiqtdadinsgnaggplldsyghtig
vntatfvnfaipidtvvrtvpylivygta

Timeline for d4ic5c_:

• d4ic5c_ first appeared in SCOPe 2.04
  
• d4ic5c_ appears in SCOPe 2.06
  
• d4ic5c_ appears in the current release, SCOPe 2.08