Lineage for d4ic5b_ (4ic5 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2407751Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2407752Protein automated matches [190438] (33 species)
    not a true protein
  7. 2408099Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256299] (1 PDB entry)
  8. 2408101Domain d4ic5b_: 4ic5 B: [252607]
    automated match to d3stia_
    complexed with ca

Details for d4ic5b_

PDB Entry: 4ic5 (more details), 2.61 Å

PDB Description: Crystal structure of Deg5
PDB Compounds: (B:) Protease Do-like 5, chloroplastic

SCOPe Domain Sequences for d4ic5b_:

Sequence, based on SEQRES records: (download)

>d4ic5b_ b.47.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eeleeeeernvnlfqktspsvvyieaielpktssgdiltdeengkiegtgsgfvwdklgh
ivtnyhviaklatdqfglqrckvslvdakgtrfskegkivgldpdndlavlkietegrel
npvvlgtsndlrvgqscfaignpygyentltigvvsglgreipspngksiseaiqtdadi
nsgnaggplldsyghtigvntatftrkgsgmssgvnfaipidtvvrtvpylivygta

Sequence, based on observed residues (ATOM records): (download)

>d4ic5b_ b.47.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eeleeeeernvnlfqktspsvvyieaielegtgsgfvwdklghivtnyhviaklatdqfg
lqrckvslvdakgtrfskegkivgldpdndlavlkietegrelnpvvlgtsndlrvgqsc
faignpygyentltigvvsglgreipspngksiseaiqtdadinsgnaggplldsyghti
gvntatfvnfaipidtvvrtvpylivygta

SCOPe Domain Coordinates for d4ic5b_:

Click to download the PDB-style file with coordinates for d4ic5b_.
(The format of our PDB-style files is described here.)

Timeline for d4ic5b_: