![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
![]() | Protein automated matches [190438] (20 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [226179] (2 PDB entries) |
![]() | Domain d3stia_: 3sti A: [216553] automated match to d1l1ja_ |
PDB Entry: 3sti (more details), 2.6 Å
SCOPe Domain Sequences for d3stia_:
Sequence, based on SEQRES records: (download)
>d3stia_ b.47.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} plpslapmlekvlpavvsvrvegtasqgqkipeefkkffgddlpdqpaqpfeglgsgvii naskgyvltnnhvinqaqkisiqlndgrefdakligsddqsdiallqiqnpskltqiaia dsdklrvgdfavavgnpfglgqtatsgivsalgrsglnleglenfiqtdasinrgnsgga llnlngeligintailapgggsvgigfaipsnmartlaqqlidfgeil
>d3stia_ b.47.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} plpslapmlekvlpavvsvlgsgviinaskgyvltnnhvikisiqlndgrefdakligsd dqsdiallqiqnpskltqiaiadsdklrvgdfavavgnpfglgqtatsgivsalgrsgln leglenfiqtdasinrgnsggallnlngeligintailvgigfaipsnmartlaqqlidf geil
Timeline for d3stia_: