Lineage for d1krsa_ (1krs A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789271Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
    barrel, closed; n=5, S=10
  6. 2789299Protein Lysyl-tRNA synthetase (LysRS) [50256] (3 species)
  7. 2789300Species Escherichia coli, gene lysS [TaxId:562] [50257] (4 PDB entries)
  8. 2789304Domain d1krsa_: 1krs A: [25256]

Details for d1krsa_

PDB Entry: 1krs (more details)

PDB Description: solution structure of the anticodon binding domain of escherichia coli lysyl-trna synthetase and studies of its interactions with trna-lys
PDB Compounds: (A:) lysyl-tRNA synthetase (product of lyss gene)

SCOPe Domain Sequences for d1krsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krsa_ b.40.4.1 (A:) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysS [TaxId: 562]}
frrdhtsdqlhaefdgkeneelealnievavagrmmtrrimgkasfvtlqdvggriqlyv
arddlpegvyneqfkkwdlgdilgakgklfktktgelsihctelrlltka

SCOPe Domain Coordinates for d1krsa_:

Click to download the PDB-style file with coordinates for d1krsa_.
(The format of our PDB-style files is described here.)

Timeline for d1krsa_: