SCOPe 2.07: Domain d1krsa_: 1krs A:

Lineage for d1krsa_ (1krs A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein Lysyl-tRNA synthetase (LysRS) [50256] (3 species)

7. Species Escherichia coli, gene lysS [TaxId:562] [50257] (4 PDB entries)

8. Domain d1krsa_: 1krs A: [25256]

Details for d1krsa_

PDB Entry: 1krs

PDB Description: solution structure of the anticodon binding domain of escherichia coli lysyl-trna synthetase and studies of its interactions with trna-lys

PDB Compounds: (A:) lysyl-tRNA synthetase (product of lyss gene)

SCOPe Domain Sequences for d1krsa_:

Sequence; same for both SEQRES and ATOM records:

>d1krsa_ b.40.4.1 (A:) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysS [TaxId: 562]}
frrdhtsdqlhaefdgkeneelealnievavagrmmtrrimgkasfvtlqdvggriqlyv
arddlpegvyneqfkkwdlgdilgakgklfktktgelsihctelrlltka

Timeline for d1krsa_:

• d1krsa_ first appeared (with stable ids) in SCOP 1.55, called d1krs__
  
• d1krsa_ appears in SCOPe 2.06
  
• d1krsa_ appears in the current release, SCOPe 2.08