SCOPe 2.08: Domain d4huwe1: 4huw E:1-181

Lineage for d4huwe1 (4huw E:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries)
   Uniprot P01901 22-299

8. Domain d4huwe1: 4huw E:1-181 [252512]
   Other proteins in same PDB: d4huwa2, d4huwb1, d4huwb2, d4huwc2, d4huwd1, d4huwd2, d4huwe2, d4huwf1, d4huwf2, d4huwg2, d4huwh1, d4huwh2
   automated match to d1kj3h2
   complexed with so4

Details for d4huwe1

PDB Entry: 4huw, 3.16 Å

PDB Description: crystal structure of h2db-npm6t

PDB Compounds: (E:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d4huwe1:

Sequence; same for both SEQRES and ATOM records:

>d4huwe1 d.19.1.1 (E:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

Timeline for d4huwe1:

• d4huwe1 first appeared in SCOPe 2.04
  
• d4huwe1 appears in SCOPe 2.07