Lineage for d4huwa1 (4huw A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938107Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries)
    Uniprot P01901 22-299
  8. 2938183Domain d4huwa1: 4huw A:1-181 [252506]
    Other proteins in same PDB: d4huwa2, d4huwb1, d4huwb2, d4huwc2, d4huwd1, d4huwd2, d4huwe2, d4huwf1, d4huwf2, d4huwg2, d4huwh1, d4huwh2
    automated match to d1kj3h2
    complexed with so4

Details for d4huwa1

PDB Entry: 4huw (more details), 3.16 Å

PDB Description: crystal structure of h2db-npm6t
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d4huwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4huwa1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOPe Domain Coordinates for d4huwa1:

Click to download the PDB-style file with coordinates for d4huwa1.
(The format of our PDB-style files is described here.)

Timeline for d4huwa1: