SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4huwc2 (4huw C:182-277)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2021514Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2021804Species Mouse (Mus musculus) [TaxId:10090] [88606] (104 PDB entries)
    Uniprot P01901 22-299
  8. 2021950Domain d4huwc2: 4huw C:182-277 [252510]
    Other proteins in same PDB: d4huwa1, d4huwb1, d4huwb2, d4huwc1, d4huwd1, d4huwd2, d4huwe1, d4huwf1, d4huwf2, d4huwg1, d4huwh1, d4huwh2
    automated match to d1fo0h1
    complexed with so4

Details for d4huwc2

PDB Entry: 4huw (more details), 3.16 Å

PDB Description: Crystal Structure of H2Db-NPM6T
PDB Compounds: (C:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d4huwc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4huwc2 b.1.1.2 (C:182-277) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwepp

SCOPe Domain Coordinates for d4huwc2:

Click to download the PDB-style file with coordinates for d4huwc2.
(The format of our PDB-style files is described here.)

Timeline for d4huwc2: