Class b: All beta proteins [48724] (180 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 |
Protein D1 core SNRNP protein [50184] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [50185] (10 PDB entries) |
Domain d4f77w_: 4f77 w: [251920] Other proteins in same PDB: d4f774_, d4f77b_, d4f77c_, d4f77d_, d4f77f_, d4f77h_, d4f77j_, d4f77k_, d4f77l_, d4f77n_, d4f77p_, d4f77r_, d4f77s_, d4f77t_, d4f77v_, d4f77x_, d4f77z_ complexed with so4 complexed with so4 |
PDB Entry: 4f77 (more details), 3.1 Å
SCOPe Domain Sequences for d4f77w_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f77w_ b.38.1.1 (w:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir gnniryfilpdslpldtllvdv
Timeline for d4f77w_: