SCOPe 2.08: Domain d4bryb_: 4bry B:

Lineage for d4bryb_ (4bry B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.28: Geminin coiled-coil domain [111469] (2 families)

5. Family h.1.28.0: automated matches [254323] (1 protein)
   not a true family

6. Protein automated matches [254741] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256213] (1 PDB entry)

8. Domain d4bryb_: 4bry B: [251321]
   Other proteins in same PDB: d4brya_
   automated match to d2zxxa_
   complexed with pg4, po4

Details for d4bryb_

PDB Entry: 4bry, 2.89 Å

PDB Description: The Idas:Geminin heterodimeric parallel coiled-coil

PDB Compounds: (B:) multicilin

SCOPe Domain Sequences for d4bryb_:

Sequence; same for both SEQRES and ATOM records:

>d4bryb_ h.1.28.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pppeqywkevadqnqralgdalvennqlhvtltqkqeeiaslkernvqlkelasrtrhla
svldklmit

Timeline for d4bryb_:

• d4bryb_ first appeared in SCOPe 2.04
  
• d4bryb_ appears in SCOPe 2.07