SCOPe 2.08: Domain d4brya_: 4bry A:

Lineage for d4brya_ (4bry A:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.28: Geminin coiled-coil domain [111469] (2 families)

5. Family h.1.28.1: Geminin coiled-coil domain [111470] (2 proteins)

6. Protein automated matches [254740] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256212] (1 PDB entry)

8. Domain d4brya_: 4bry A: [251320]
   Other proteins in same PDB: d4bryb_
   automated match to d2zxxb_
   complexed with pg4, po4

Details for d4brya_

PDB Entry: 4bry, 2.89 Å

PDB Description: The Idas:Geminin heterodimeric parallel coiled-coil

PDB Compounds: (A:) Geminin

SCOPe Domain Sequences for d4brya_:

Sequence; same for both SEQRES and ATOM records:

>d4brya_ h.1.28.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
enpssqywkevaekrrkalyealkeneklhkeieqkdneiarlkkenkelaevaehvqym
aelierlng

Timeline for d4brya_:

• d4brya_ first appeared in SCOPe 2.04
  
• d4brya_ appears in SCOPe 2.07