PDB entry 4bry

View 4bry on RCSB PDB site
Description: The Idas:Geminin heterodimeric parallel coiled-coil
Class: cell cycle
Keywords: cell cycle, DNA replication licensing
Deposited on 2013-06-06, released 2013-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: 0.204
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geminin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4brya_
  • Chain 'B':
    Compound: multicilin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4bryb_
  • Heterogens: PG4, PO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4bryA (A:)
    qesfdlmikenpssqywkevaekrrkalyealkeneklhkeieqkdneiarlkkenkela
    evaehvqymaelierlng
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bryA (A:)
    enpssqywkevaekrrkalyealkeneklhkeieqkdneiarlkkenkelaevaehvqym
    aelierlng
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4bryB (B:)
    pdvpppeqywkevadqnqralgdalvennqlhvtltqkqeeiaslkernvqlkelasrtr
    hlasvldklmitq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4bryB (B:)
    pppeqywkevadqnqralgdalvennqlhvtltqkqeeiaslkernvqlkelasrtrhla
    svldklmit