Lineage for d4bqka1 (4bqk A:73-494)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006908Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2006909Protein automated matches [190220] (14 species)
    not a true protein
  7. 2007001Species Rice (Oryza sativa) [TaxId:4530] [256208] (2 PDB entries)
  8. 2007002Domain d4bqka1: 4bqk A:73-494 [251302]
    Other proteins in same PDB: d4bqka2
    automated match to d1y2ac_
    complexed with peg

Details for d4bqka1

PDB Entry: 4bqk (more details), 2 Å

PDB Description: rice importin_alpha : VirD2NLS complex
PDB Compounds: (A:) importin subunit alpha-1a

SCOPe Domain Sequences for d4bqka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bqka1 a.118.1.0 (A:73-494) automated matches {Rice (Oryza sativa) [TaxId: 4530]}
slpamiggvysddnnlqleattqfrkllsiersppieeviqsgvvprfvqfltredfpql
qfeaawaltniasgtsentkvvidhgavpifvkllgsssddvreqavwalgnvagdspkc
rdlvlangallpllaqlnehtklsmlrnatwtlsnfcrgkpqpsfeqtrpalpalarlih
sndeevltdacwalsylsdgtndkiqavieagvcprlvelllhpspsvlipalrtvgniv
tgddaqtqciidhqalpcllslltqnlkksikkeacwtisnitagnkdqiqavinagiig
plvnllqtaefdikkeaawaisnatsggshdqikylvsegcikplcdllicpdirivtvc
leglenilkvgetdktlaagdvnvfsqmideaeglekienlqshdnneiyekavkileay
wm

SCOPe Domain Coordinates for d4bqka1:

Click to download the PDB-style file with coordinates for d4bqka1.
(The format of our PDB-style files is described here.)

Timeline for d4bqka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bqka2
View in 3D
Domains from other chains:
(mouse over for more information)
d4bqkb_