SCOPe 2.08: Domain d4ulla_: 4ull A:

Lineage for d4ulla_ (4ull A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
   phage-borne toxin; bacteriophages H30 and H19B

7. Species Escherichia coli [TaxId:562] [50211] (17 PDB entries)

8. Domain d4ulla_: 4ull A: [25100]

Details for d4ulla_

PDB Entry: 4ull

PDB Description: solution nmr structure of verotoxin-1 b-subunit from e. coli, 5 structures

PDB Compounds: (A:) Shiga toxin 1B

SCOPe Domain Sequences for d4ulla_:

Sequence; same for both SEQRES and ATOM records:

>d4ulla_ b.40.2.1 (A:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

Timeline for d4ulla_:

• d4ulla_ first appeared (with stable ids) in SCOP 1.55, called d4ull__
  
• d4ulla_ appears in SCOPe 2.07