PDB entry 4ull

View 4ull on RCSB PDB site
Description: solution nmr structure of verotoxin-1 b-subunit from e. coli, 5 structures
Class: toxin
Keywords: toxin
Deposited on 1996-12-17, released 1997-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Shiga toxin 1B
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8G8Y6 (0-68)
  Domains in SCOPe 2.08: d4ulla_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4ullA (A:)
  tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
  ggfsevifr