Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species) phage-borne toxin; bacteriophages H30 and H19B |
Species Escherichia coli [TaxId:562] [50211] (17 PDB entries) |
Domain d1czgd_: 1czg D: [25098] mutant |
PDB Entry: 1czg (more details), 2.5 Å
SCOPe Domain Sequences for d1czgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1czgd_ b.40.2.1 (D:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]} tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng gtfsevifr
Timeline for d1czgd_:
View in 3D Domains from other chains: (mouse over for more information) d1czga_, d1czgb_, d1czgc_, d1czge_ |