PDB entry 1czg

View 1czg on RCSB PDB site
Description: structure of the g62t mutant of shiga-like toxin I b subunit
Class: toxin
Keywords: bacterial toxin, sugar receptor binding domain, protein-carbohydrate recognition, ob-fold, toxin
Deposited on 1999-09-03, released 2000-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: shiga toxin b-chain
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178
      • engineered (61)
    Domains in SCOPe 2.07: d1czga_
  • Chain 'B':
    Compound: shiga toxin b-chain
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178
      • engineered (61)
    Domains in SCOPe 2.07: d1czgb_
  • Chain 'C':
    Compound: shiga toxin b-chain
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178
      • engineered (61)
    Domains in SCOPe 2.07: d1czgc_
  • Chain 'D':
    Compound: shiga toxin b-chain
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178
      • engineered (61)
    Domains in SCOPe 2.07: d1czgd_
  • Chain 'E':
    Compound: shiga toxin b-chain
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178 (0-68)
      • engineered (61)
    Domains in SCOPe 2.07: d1czge_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czgA (A:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czgB (B:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czgC (C:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czgD (D:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czgE (E:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr