Lineage for d1bosi_ (1bos I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788585Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 2788592Species Escherichia coli [TaxId:562] [50211] (17 PDB entries)
  8. 2788681Domain d1bosi_: 1bos I: [25083]
    complexed with bgc, gal, gla

Details for d1bosi_

PDB Entry: 1bos (more details), 2.8 Å

PDB Description: shiga-like toxin complexed with its receptor
PDB Compounds: (I:) shiga-like toxin I b subunit

SCOPe Domain Sequences for d1bosi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bosi_ b.40.2.1 (I:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOPe Domain Coordinates for d1bosi_:

Click to download the PDB-style file with coordinates for d1bosi_.
(The format of our PDB-style files is described here.)

Timeline for d1bosi_: