PDB entry 1bos

View 1bos on RCSB PDB site
Description: shiga-like toxin complexed with its receptor
Class: toxin
Keywords: toxin, receptor binding, protein-carbohydrate recognition, ob-fold
Deposited on 1998-01-13, released 1999-02-02
Made obsolete on 2020-10-22

The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-21, with a file datestamp of 2009-07-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.17
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bosa_
  • Chain 'B':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bosb_
  • Chain 'C':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bosc_
  • Chain 'D':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bosd_
  • Chain 'E':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bose_
  • Chain 'F':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bosf_
  • Chain 'G':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bosg_
  • Chain 'H':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bosh_
  • Chain 'I':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bosi_
  • Chain 'J':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bosj_
  • Chain 'K':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bosk_
  • Chain 'L':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bosl_
  • Chain 'M':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bosm_
  • Chain 'N':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bosn_
  • Chain 'O':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1boso_
  • Chain 'P':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bosp_
  • Chain 'Q':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bosq_
  • Chain 'R':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bosr_
  • Chain 'S':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1boss_
  • Chain 'T':
    Compound: shiga-like toxin I b subunit
    Species: , [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bost_
  • Heterogens: GAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosA (A:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosB (B:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosC (C:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosD (D:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosE (E:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosF (F:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosG (G:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosH (H:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosI (I:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosJ (J:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosK (K:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosL (L:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosM (M:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosN (N:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosO (O:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosP (P:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosQ (Q:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosR (R:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosS (S:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bosT (T:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr