Lineage for d3zg5b1 (3zg5 B:27-138)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2544255Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2544256Protein automated matches [190205] (33 species)
    not a true protein
  7. 2544375Species Staphylococcus aureus [TaxId:1280] [256158] (3 PDB entries)
  8. 2544377Domain d3zg5b1: 3zg5 B:27-138 [250788]
    Other proteins in same PDB: d3zg5a2, d3zg5a3, d3zg5b2, d3zg5b3
    automated match to d1vqqa1
    complexed with cd, cl

Details for d3zg5b1

PDB Entry: 3zg5 (more details), 2.55 Å

PDB Description: crystal structure of pbp2a from mrsa in complex with peptidoglycan analogue at allosteric
PDB Compounds: (B:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d3zg5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zg5b1 d.17.4.0 (B:27-138) automated matches {Staphylococcus aureus [TaxId: 1280]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

SCOPe Domain Coordinates for d3zg5b1:

Click to download the PDB-style file with coordinates for d3zg5b1.
(The format of our PDB-style files is described here.)

Timeline for d3zg5b1: