Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (26 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [256158] (3 PDB entries) |
Domain d3zg5b1: 3zg5 B:27-138 [250788] Other proteins in same PDB: d3zg5a2, d3zg5a3, d3zg5b2, d3zg5b3 automated match to d1vqqa1 complexed with cd, cl |
PDB Entry: 3zg5 (more details), 2.55 Å
SCOPe Domain Sequences for d3zg5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zg5b1 d.17.4.0 (B:27-138) automated matches {Staphylococcus aureus [TaxId: 1280]} dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk
Timeline for d3zg5b1: