SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1czwa_ (1czw A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2050241Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2050242Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 protein domains)
  6. 2050555Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 2050562Species Escherichia coli [TaxId:562] [50211] (15 PDB entries)
  8. 2050603Domain d1czwa_: 1czw A: [25060]
    mutant

Details for d1czwa_

PDB Entry: 1czw (more details), 2.5 Å

PDB Description: structure of the w34a mutant of shiga-like toxin i b subunit
PDB Compounds: (A:) shiga toxin b-chain

SCOPe Domain Sequences for d1czwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1czwa_ b.40.2.1 (A:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOPe Domain Coordinates for d1czwa_:

Click to download the PDB-style file with coordinates for d1czwa_.
(The format of our PDB-style files is described here.)

Timeline for d1czwa_: