PDB entry 1czw

View 1czw on RCSB PDB site
Description: structure of the w34a mutant of shiga-like toxin I b subunit
Class: toxin
Keywords: bacterial toxin, sugar receptor binding domain, protein-carbohydrate recognition, ob-fold, toxin
Deposited on 1999-09-07, released 2000-09-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: shiga toxin b-chain
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178
      • engineered mutation (33)
    Domains in SCOPe 2.08: d1czwa_
  • Chain 'B':
    Compound: shiga toxin b-chain
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178
      • engineered mutation (33)
    Domains in SCOPe 2.08: d1czwb_
  • Chain 'C':
    Compound: shiga toxin b-chain
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178
      • engineered mutation (33)
    Domains in SCOPe 2.08: d1czwc_
  • Chain 'D':
    Compound: shiga toxin b-chain
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178
      • engineered mutation (33)
    Domains in SCOPe 2.08: d1czwd_
  • Chain 'E':
    Compound: shiga toxin b-chain
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178 (0-68)
      • engineered mutation (33)
    Domains in SCOPe 2.08: d1czwe_
  • Chain 'F':
    Compound: shiga toxin b-chain
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178
      • engineered mutation (33)
    Domains in SCOPe 2.08: d1czwf_
  • Chain 'G':
    Compound: shiga toxin b-chain
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178
      • engineered mutation (33)
    Domains in SCOPe 2.08: d1czwg_
  • Chain 'H':
    Compound: shiga toxin b-chain
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178
      • engineered mutation (33)
    Domains in SCOPe 2.08: d1czwh_
  • Chain 'I':
    Compound: shiga toxin b-chain
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178
      • engineered mutation (33)
    Domains in SCOPe 2.08: d1czwi_
  • Chain 'J':
    Compound: shiga toxin b-chain
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178 (0-68)
      • engineered mutation (33)
    Domains in SCOPe 2.08: d1czwj_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czwA (A:)
    tpdcvtgkveytkyndddtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czwB (B:)
    tpdcvtgkveytkyndddtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czwC (C:)
    tpdcvtgkveytkyndddtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czwD (D:)
    tpdcvtgkveytkyndddtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czwE (E:)
    tpdcvtgkveytkyndddtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czwF (F:)
    tpdcvtgkveytkyndddtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czwG (G:)
    tpdcvtgkveytkyndddtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czwH (H:)
    tpdcvtgkveytkyndddtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czwI (I:)
    tpdcvtgkveytkyndddtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1czwJ (J:)
    tpdcvtgkveytkyndddtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
    ggfsevifr