Lineage for d1qohr_ (1qoh R:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228613Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 228614Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 228836Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (2 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 228837Species Escherichia coli [TaxId:562] [50211] (12 PDB entries)
  8. 228926Domain d1qohr_: 1qoh R: [25052]

Details for d1qohr_

PDB Entry: 1qoh (more details), 2.35 Å

PDB Description: a mutant shiga-like toxin iie

SCOP Domain Sequences for d1qohr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qohr_ b.40.2.1 (R:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli}
adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs
gfaevqfn

SCOP Domain Coordinates for d1qohr_:

Click to download the PDB-style file with coordinates for d1qohr_.
(The format of our PDB-style files is described here.)

Timeline for d1qohr_: