| Class b: All beta proteins [48724] (119 folds) |
| Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) ![]() |
| Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) |
| Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (2 species) phage-borne toxin; bacteriophages H30 and H19B |
| Species Escherichia coli [TaxId:562] [50211] (12 PDB entries) |
| Domain d1qohm_: 1qoh M: [25047] |
PDB Entry: 1qoh (more details), 2.35 Å
SCOP Domain Sequences for d1qohm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qohm_ b.40.2.1 (M:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli}
adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs
gfaevqfn
Timeline for d1qohm_: