![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
![]() | Protein automated matches [226927] (18 species) not a true protein |
![]() | Species Zebrafish (Danio rerio) [TaxId:7955] [233796] (3 PDB entries) |
![]() | Domain d3ukva_: 3ukv A: [250219] automated match to d3ukna_ |
PDB Entry: 3ukv (more details), 2.7 Å
SCOPe Domain Sequences for d3ukva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ukva_ b.82.3.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} slyhtrtkdlkdfirvhrlpkalaqrmlecfqttwsvnngidvsellkdfpdelradiam hlnkellqlplfesasrgclrslsliiktsfcapgeflirqgdalqaiyfvcsgsmevlk dntvlailgkgdligsdsltkeqviktnanvkaltycdlqyislkglrevlrlypeyaqk fvseiqhdltynlre
Timeline for d3ukva_: