SCOPe 2.07: Domain d3ukvb_: 3ukv B:

Lineage for d3ukvb_ (3ukv B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (18 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [233796] (3 PDB entries)

8. Domain d3ukvb_: 3ukv B: [250220]
   automated match to d3uknb_

Details for d3ukvb_

PDB Entry: 3ukv, 2.7 Å

PDB Description: Structure of the C-linker/CNBHD of zELK channels in P 1 21 1 space group, crystallized in the presence of cAMP

PDB Compounds: (B:) Novel protein similar to vertebrate potassium voltage-gated channel, subfamily H (Eag-related) family

SCOPe Domain Sequences for d3ukvb_:

Sequence; same for both SEQRES and ATOM records:

>d3ukvb_ b.82.3.0 (B:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
rrslyhtrtkdlkdfirvhrlpkalaqrmlecfqttwsvnngidvsellkdfpdelradi
amhlnkellqlplfesasrgclrslsliiktsfcapgeflirqgdalqaiyfvcsgsmev
lkdntvlailgkgdligsdsltkeqviktnanvkaltycdlqyislkglrevlrlypeya
qkfvseiqhdltynlr

Timeline for d3ukvb_:

• d3ukvb_ first appeared in SCOPe 2.04
  
• d3ukvb_ appears in SCOPe 2.06
  
• d3ukvb_ appears in the current release, SCOPe 2.08