Lineage for d3ufga1 (3ufg A:1-284)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2967618Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2967844Protein automated matches [193659] (8 species)
    not a true protein
  7. 2967851Species Campylobacter jejuni [TaxId:197] [256056] (2 PDB entries)
  8. 2967854Domain d3ufga1: 3ufg A:1-284 [250210]
    Other proteins in same PDB: d3ufga2, d3ufgb2
    automated match to d1j5wa_
    protein/RNA complex; complexed with atp, leu

Details for d3ufga1

PDB Entry: 3ufg (more details), 2.55 Å

PDB Description: The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC in complex with ATP
PDB Compounds: (A:) Glycyl-tRNA synthetase alpha subunit

SCOPe Domain Sequences for d3ufga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ufga1 d.104.1.1 (A:1-284) automated matches {Campylobacter jejuni [TaxId: 197]}
mtfsqmilnlqnywqeqgcaimqpydmpagagtfhpatflrslgkkpwaaayvapsrrpt
dgrygenpnrlgayyqfqvlikpspdniqelylkslenlgfdlkshdirfvednwespsl
gawglgwevwldgmevtqftyfqqvggiavdlvsaeitygleriamylqnvdnvydivws
efngekikyadvhkqseyefskynfevsdvkilneqfensykecknileqglalpaydyc
mlaahtfnlldargaisvaqrqdymlkirelskncaeiykknln

SCOPe Domain Coordinates for d3ufga1:

Click to download the PDB-style file with coordinates for d3ufga1.
(The format of our PDB-style files is described here.)

Timeline for d3ufga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ufga2