SCOPe 2.08: Domain d3ufgb1: 3ufg B:1-284

Lineage for d3ufgb1 (3ufg B:1-284)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein automated matches [193659] (8 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:197] [256056] (2 PDB entries)

8. Domain d3ufgb1: 3ufg B:1-284 [250211]
   Other proteins in same PDB: d3ufga2, d3ufgb2
   automated match to d1j5wa_
   protein/RNA complex; complexed with atp, leu

Details for d3ufgb1

PDB Entry: 3ufg, 2.55 Å

PDB Description: The crystal structure of glycyl-tRNA synthetase subunit alpha from Campylobacter jejuni subsp. jejuni NCTC in complex with ATP

PDB Compounds: (B:) Glycyl-tRNA synthetase alpha subunit

SCOPe Domain Sequences for d3ufgb1:

Sequence; same for both SEQRES and ATOM records:

>d3ufgb1 d.104.1.1 (B:1-284) automated matches {Campylobacter jejuni [TaxId: 197]}
mtfsqmilnlqnywqeqgcaimqpydmpagagtfhpatflrslgkkpwaaayvapsrrpt
dgrygenpnrlgayyqfqvlikpspdniqelylkslenlgfdlkshdirfvednwespsl
gawglgwevwldgmevtqftyfqqvggiavdlvsaeitygleriamylqnvdnvydivws
efngekikyadvhkqseyefskynfevsdvkilneqfensykecknileqglalpaydyc
mlaahtfnlldargaisvaqrqdymlkirelskncaeiykknln

Timeline for d3ufgb1:

• d3ufgb1 first appeared in SCOPe 2.04, called d3ufgb_
  
• d3ufgb1 appears in SCOPe 2.07