Class b: All beta proteins [48724] (178 folds) |
Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily) (homo)trimer; each chain donates 3 beta-strands per turn of the helix |
Superfamily b.108.1: Phage fibre proteins [69349] (6 families) |
Family b.108.1.0: automated matches [231970] (1 protein) not a true family |
Protein automated matches [231971] (3 species) not a true protein |
Species Lactococcus phage [TaxId:35345] [231972] (5 PDB entries) |
Domain d3u6xn1: 3u6x N:2-62 [250127] Other proteins in same PDB: d3u6xa2, d3u6xa3, d3u6xb2, d3u6xb3, d3u6xc2, d3u6xc3, d3u6xd2, d3u6xd3, d3u6xe2, d3u6xe3, d3u6xf2, d3u6xf3, d3u6xg2, d3u6xg3, d3u6xh2, d3u6xh3, d3u6xi2, d3u6xi3, d3u6xj2, d3u6xj3, d3u6xk2, d3u6xk3, d3u6xl2, d3u6xl3, d3u6xm2, d3u6xm3, d3u6xn2, d3u6xn3, d3u6xo2, d3u6xo3, d3u6xp2, d3u6xp3, d3u6xq2, d3u6xq3, d3u6xr2, d3u6xr3 automated match to d2f0ca2 complexed with br |
PDB Entry: 3u6x (more details), 2.6 Å
SCOPe Domain Sequences for d3u6xn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u6xn1 b.108.1.0 (N:2-62) automated matches {Lactococcus phage [TaxId: 35345]} asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt l
Timeline for d3u6xn1:
View in 3D Domains from other chains: (mouse over for more information) d3u6xa1, d3u6xa2, d3u6xa3, d3u6xb1, d3u6xb2, d3u6xb3, d3u6xc1, d3u6xc2, d3u6xc3, d3u6xd1, d3u6xd2, d3u6xd3, d3u6xe1, d3u6xe2, d3u6xe3, d3u6xf1, d3u6xf2, d3u6xf3, d3u6xg1, d3u6xg2, d3u6xg3, d3u6xh1, d3u6xh2, d3u6xh3, d3u6xi1, d3u6xi2, d3u6xi3, d3u6xj1, d3u6xj2, d3u6xj3, d3u6xk1, d3u6xk2, d3u6xk3, d3u6xl1, d3u6xl2, d3u6xl3, d3u6xm1, d3u6xm2, d3u6xm3, d3u6xo1, d3u6xo2, d3u6xo3, d3u6xp1, d3u6xp2, d3u6xp3, d3u6xq1, d3u6xq2, d3u6xq3, d3u6xr1, d3u6xr2, d3u6xr3 |