Lineage for d3u6xg1 (3u6x G:2-62)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430315Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
    (homo)trimer; each chain donates 3 beta-strands per turn of the helix
  4. 2430316Superfamily b.108.1: Phage fibre proteins [69349] (6 families) (S)
  5. 2430364Family b.108.1.0: automated matches [231970] (1 protein)
    not a true family
  6. 2430365Protein automated matches [231971] (3 species)
    not a true protein
  7. 2430377Species Lactococcus phage [TaxId:35345] [231972] (5 PDB entries)
  8. 2430390Domain d3u6xg1: 3u6x G:2-62 [250113]
    Other proteins in same PDB: d3u6xa2, d3u6xa3, d3u6xb2, d3u6xb3, d3u6xc2, d3u6xc3, d3u6xd2, d3u6xd3, d3u6xe2, d3u6xe3, d3u6xf2, d3u6xf3, d3u6xg2, d3u6xg3, d3u6xh2, d3u6xh3, d3u6xi2, d3u6xi3, d3u6xj2, d3u6xj3, d3u6xk2, d3u6xk3, d3u6xl2, d3u6xl3, d3u6xm2, d3u6xm3, d3u6xn2, d3u6xn3, d3u6xo2, d3u6xo3, d3u6xp2, d3u6xp3, d3u6xq2, d3u6xq3, d3u6xr2, d3u6xr3
    automated match to d2f0ca2
    complexed with br

Details for d3u6xg1

PDB Entry: 3u6x (more details), 2.6 Å

PDB Description: Phage TP901-1 baseplate tripod
PDB Compounds: (G:) bpp

SCOPe Domain Sequences for d3u6xg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u6xg1 b.108.1.0 (G:2-62) automated matches {Lactococcus phage [TaxId: 35345]}
asikkvyrgmkngaetinddleainseltsggnvvhktgdetiagkktftgnvevngslt
l

SCOPe Domain Coordinates for d3u6xg1:

Click to download the PDB-style file with coordinates for d3u6xg1.
(The format of our PDB-style files is described here.)

Timeline for d3u6xg1:

View in 3D
Domains from other chains:
(mouse over for more information)
d3u6xa1, d3u6xa2, d3u6xa3, d3u6xb1, d3u6xb2, d3u6xb3, d3u6xc1, d3u6xc2, d3u6xc3, d3u6xd1, d3u6xd2, d3u6xd3, d3u6xe1, d3u6xe2, d3u6xe3, d3u6xf1, d3u6xf2, d3u6xf3, d3u6xh1, d3u6xh2, d3u6xh3, d3u6xi1, d3u6xi2, d3u6xi3, d3u6xj1, d3u6xj2, d3u6xj3, d3u6xk1, d3u6xk2, d3u6xk3, d3u6xl1, d3u6xl2, d3u6xl3, d3u6xm1, d3u6xm2, d3u6xm3, d3u6xn1, d3u6xn2, d3u6xn3, d3u6xo1, d3u6xo2, d3u6xo3, d3u6xp1, d3u6xp2, d3u6xp3, d3u6xq1, d3u6xq2, d3u6xq3, d3u6xr1, d3u6xr2, d3u6xr3