SCOPe 2.07: Domain d3u6xa2: 3u6x A:63-163

Lineage for d3u6xa2 (3u6x A:63-163)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins)
   automatically mapped to Pfam PF08932

6. Protein automated matches [232461] (1 species)
   not a true protein

7. Species Lactococcus phage [TaxId:35345] [232462] (6 PDB entries)

8. Domain d3u6xa2: 3u6x A:63-163 [250102]
   Other proteins in same PDB: d3u6xa1, d3u6xa3, d3u6xb1, d3u6xb3, d3u6xc1, d3u6xc3, d3u6xd1, d3u6xd3, d3u6xe1, d3u6xe3, d3u6xf1, d3u6xf3, d3u6xg1, d3u6xg3, d3u6xh1, d3u6xh3, d3u6xi1, d3u6xi3, d3u6xj1, d3u6xj3, d3u6xk1, d3u6xk3, d3u6xl1, d3u6xl3, d3u6xm1, d3u6xm3, d3u6xn1, d3u6xn3, d3u6xo1, d3u6xo3, d3u6xp1, d3u6xp3, d3u6xq1, d3u6xq3, d3u6xr1, d3u6xr3
   automated match to d2f0ca1
   complexed with br

Details for d3u6xa2

PDB Entry: 3u6x, 2.6 Å

PDB Description: Phage TP901-1 baseplate tripod

PDB Compounds: (A:) bpp

SCOPe Domain Sequences for d3u6xa2:

Sequence; same for both SEQRES and ATOM records:

>d3u6xa2 b.21.1.3 (A:63-163) automated matches {Lactococcus phage [TaxId: 35345]}
ptkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslv
ghmvggwnafhidipssgvcqwfgptassgtprgtgtypid

Timeline for d3u6xa2:

• d3u6xa2 first appeared in SCOPe 2.04
  
• d3u6xa2 appears in SCOPe 2.06
  
• d3u6xa2 appears in the current release, SCOPe 2.08