Lineage for d3t45b_ (3t45 B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022990Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 3022991Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 3022992Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)
  6. 3022997Protein Bacteriorhodopsin [56871] (3 species)
    a light-driven proton pump
  7. 3023143Species Halobacterium sp. [TaxId:64091] [346420] (7 PDB entries)
  8. 3023153Domain d3t45b_: 3t45 B: [249775]
    automated match to d1r84a_
    complexed with li1, ret; mutant

Details for d3t45b_

PDB Entry: 3t45 (more details), 3.01 Å

PDB Description: crystal structure of bacteriorhodopsin mutant a215t, a phototaxis signaling mutant at 3.0 a resolution
PDB Compounds: (B:) Bacteriorhodopsin (GROUND STATE)

SCOPe Domain Sequences for d3t45b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3t45b_ f.13.1.1 (B:) Bacteriorhodopsin {Halobacterium sp. [TaxId: 64091]}
rpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgygl
tmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvga
ltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsayp
vvwligsegagivplnietllfmvldvstkvgfglillrsraifg

SCOPe Domain Coordinates for d3t45b_:

Click to download the PDB-style file with coordinates for d3t45b_.
(The format of our PDB-style files is described here.)

Timeline for d3t45b_: